PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678446577
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family TALE
Protein Properties Length: 371aa    MW: 42118.3 Da    PI: 7.5166
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678446577genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.62.1e-083023362155
                HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
   Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                k +yps++e+  L + +gL+++q+ +WF N+R ++
  678446577 302 KWPYPSESEKVALGEATGLDQKQINNWFINQRKRH 336
                569*****************************885 PP

2ELK31.92.9e-11257277222
        ELK   2 LKhqLlrKYsgyLgsLkqEFs 22 
                LK+ L++KY+gyL++LkqEFs
  678446577 257 LKNYLRNKYRGYLSTLKQEFS 277
                9*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012558.3E-18114158IPR005540KNOX1
PfamPF037903.3E-19115155IPR005540KNOX1
SMARTSM012563.0E-21165216IPR005541KNOX2
PfamPF037911.7E-19170215IPR005541KNOX2
SMARTSM011885.5E-5256277IPR005539ELK domain
PfamPF037893.0E-7256277IPR005539ELK domain
PROSITE profilePS5121310.371256276IPR005539ELK domain
PROSITE profilePS5007111.92276339IPR001356Homeobox domain
SMARTSM003894.5E-10278343IPR001356Homeobox domain
SuperFamilySSF466892.14E-17278348IPR009057Homeodomain-like
CDDcd000866.03E-12279340No hitNo description
Gene3DG3DSA:1.10.10.601.3E-25281340IPR009057Homeodomain-like
PfamPF059207.8E-16296335IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MGWGRQSIWV FIWWGFLRMD GYDRPMHGHL SCPGDGGLLY GAGGSGHDLP LRQLGFTGFH  60
HLQPLQQQQH QPTSVKTEYG AWQDDHETKF QFPPANTPSH ERRCSGEESG EAIAAMKSKI  120
VAHPQYPNLI QAYIDCHKVG APPETVARLV QLRQDLEPPR PTSGSTTQDS SDPELDRFME  180
AYCNMLVKLR EKLTTPLEEA MEFMRTAEAQ LSQITNPPPP TDHNPRGDGG SADGYHGGAR  240
GGEEESGVDP RAMDPQLKNY LRNKYRGYLS TLKQEFSRKK KKGKLPREAR QKMLTWWQLH  300
YKWPYPSESE KVALGEATGL DQKQINNWFI NQRKRHWKPS DEVELMVMDG LQHHHCNGAQ  360
YLGHGPYSLG P
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011074319.11e-105PREDICTED: homeotic protein knotted-1
SwissprotP466391e-104KNAT1_ARATH; Homeobox protein knotted-1-like 1
TrEMBLR0FIH21e-103R0FIH2_9BRAS; Uncharacterized protein
STRINGAT4G08150.11e-102(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49732333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-100KNOTTED-like from Arabidopsis thaliana